PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_20776_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family VOZ
Protein Properties Length: 328aa    MW: 35793.3 Da    PI: 5.0534
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_20776_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ171.44.4e-53209303195
             VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaael 95 
                     pppsaflgpkcalwdc+rpaqg++w+qdycssfha+lal eg+pg+ pvlrp+gi+lkdgllfaal ak+qgk+vgipecegaat+kspwna+  
  Neem_20776_f_1 209 PPPSAFLGPKCALWDCPRPAQGMDWCQDYCSSFHAALALSEGPPGMGPVLRPGGIGLKDGLLFAALGAKAQGKDVGIPECEGAATSKSPWNAPGK 303
                     89******************************************************************************************965 PP

Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MGKGSKTNCK SASHKLFKDK AKNRVDDLQG MFMDLQYARK ESRSVDVAVL EEQVHQMLRE  60
WKAELNEPSP ATSLQQEGSL ATFSSDIYRL LQLCEEEDDA TSKLAAPKPE PNDQILPARD  120
SAVFHEVGYG VNQGQQQHGF PLVDQCKNSP SGVHGTTMNN LEGSTLLDYN HFDLHQDFEQ  180
NFYTGFNVST FGGEDAMHQI SGYLPSICPP PSAFLGPKCA LWDCPRPAQG MDWCQDYCSS  240
FHAALALSEG PPGMGPVLRP GGIGLKDGLL FAALGAKAQG KDVGIPECEG AATSKSPWNA  300
PGKCILAALH IQYITRSCNF EVSMECSW
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006467710.10.0PREDICTED: transcription factor VOZ1 isoform X1
RefseqXP_006467711.10.0PREDICTED: transcription factor VOZ1 isoform X1
SwissprotQ9SGQ01e-151VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A067GDH60.0A0A067GDH6_CITSI; Uncharacterized protein
STRINGPOPTR_0004s05030.11e-175(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM66672745
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-153vascular plant one zinc finger protein